NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335078_10005381

Scaffold Ga0335078_10005381


Overview

Basic Information
Taxon OID3300032805 Open in IMG/M
Scaffold IDGa0335078_10005381 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)18926
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (70.83%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5065Long. (o)-80.2537Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003832Metagenome / Metatranscriptome466Y
F005268Metagenome / Metatranscriptome406Y
F014888Metagenome / Metatranscriptome259Y
F025325Metagenome / Metatranscriptome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0335078_100053815F025325GGAGGMLGDGPKPLEKTWEELAAAASTETDPEKLAMVLEEIFAALAKRERSLSPPRNPSGLRLTE
Ga0335078_100053816F005268GAGGVSRPEEETEEQQLWRVLSEAGLVEIRLDEFAERIRDVKGIVIARLRELLDFNSGIQERESAAYSLGALRGLELKVLANAPTTSDPSEP
Ga0335078_100053817F003832N/AMKSTAQQLRTDANWPPEEGEFISFKSPAGTETTILREVRLGLLWRDFILEDGRVIPEHRVSGCPRPQVWRKIDEVSDRERQECEERLLSMAGAGMDPRERDQPFWAELNQYLAYTYLRFKQTGHKAQDTDQRQADWQ
Ga0335078_100053819F014888AGGAGMSKVLEVLLTVVALAGLYSAIPASVPRHGSSVIRAEQAVVVADGSDPMPTCRGKRCIP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.