Scaffold Ga0310342_100756410

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0310342_100756410

Scaffold Ga0310342_100756410

Overview

Basic Information
Taxon OID	3300032820 Open in IMG/M
Scaffold ID	Ga0310342_100756410 Open in IMG/M
Source Dataset Name	Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1120
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Hahellaceae → Hahella → Hahella ganghwensis	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Comprehensive Metagenome And Single Cell Genome Sequencing From The Open Ocean Community Of North Pacfic Subtropical Gyre, Station Aloha

Source Dataset Sampling Location
Location Name	Pacific Ocean: North Pacific Subtropical Gyre
Coordinates	Lat. (^o)	22.8644	Long. (^o)	-158.9436	Alt. (m)		Depth (m)	500
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078828	Metagenome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0310342_1007564103	F078828	N/A	GDIMEQKESQYNWSELAYKIDPELSAPVKQYEFDDGRRVFYKPKKRNQYGTRKR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.