Scaffold Ga0335074_10025944

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0335074_10025944

Scaffold Ga0335074_10025944

Overview

Basic Information
Taxon OID	3300032895 Open in IMG/M
Scaffold ID	Ga0335074_10025944 Open in IMG/M
Source Dataset Name	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8252
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (70.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location Name	USA: Florida
Coordinates	Lat. (^o)	26.5059	Long. (^o)	-80.2517	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025532	Metagenome / Metatranscriptome	201	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0335074_100259441	F025532	N/A	MFVRDLSELAFDRMSTEGAVERLAIGRGIAAPLIGALVAATGDLPVDAVAEVVADRDAMLRGAKQHIVVEYAREP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.