Basic Information | |
---|---|
Taxon OID | 3300033171 Open in IMG/M |
Scaffold ID | Ga0334895_1136084 Open in IMG/M |
Source Dataset Name | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_31_05-R3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 600 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Netherlands: Wageningen, Gelderland | |||||||
Coordinates | Lat. (o) | 51.9691 | Long. (o) | 5.6654 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031354 | Metagenome / Metatranscriptome | 182 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0334895_11360841 | F031354 | N/A | YRQYTGSNKVTKTEGKGIWLMKTTFDISDILYPIINVTSVTGTIDGRVYRDKKPLNSELQDIVIIPLTNYNGDEIIQFPVYMVNCFCKNFDNGLPNITKLKTITDAVIKVIEDYSATSNYYVFEITNQTLMQDTDQISMSYVNLRINCYIEK |
⦗Top⦘ |