Scaffold Ga0307507_10000871

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307507_10000871

Scaffold Ga0307507_10000871

Overview

Basic Information
Taxon OID	3300033179 Open in IMG/M
Scaffold ID	Ga0307507_10000871 Open in IMG/M
Source Dataset Name	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	66995
Total Scaffold Genes	38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	17 (44.74%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location Name	USA: Oregon
Coordinates	Lat. (^o)	44.5508	Long. (^o)	-123.25	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032886	Metagenome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307507_100008719	F032886	AGCAG	MELEYLLINSDKNKKEANWEHLNLNNVIEAETKTITKQGSVTDVITPLDTISIAL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.