NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307510_10000006

Scaffold Ga0307510_10000006


Overview

Basic Information
Taxon OID3300033180 Open in IMG/M
Scaffold IDGa0307510_10000006 Open in IMG/M
Source Dataset NamePopulus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)566474
Total Scaffold Genes535 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)416 (77.76%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)45.654Long. (o)-122.839Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002655Metagenome / Metatranscriptome539Y
F051460Metagenome / Metatranscriptome144Y
F075326Metagenome / Metatranscriptome119Y
F094031Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0307510_100000061F094031GGAGMKIENLSKDLDTVAMTEVTGGTALTGQVVPTNVQSNALEQAFQSKR
Ga0307510_100000062F002655GGAGMKIENLSHDLDASAMTAVTGGTALTGQVVPTNVQSNALGQGFQVASCAPVAIGNDAEQSNYSSQETDLPVGSLIVSIPRCY
Ga0307510_10000006388F051460GAGGMMQTDGLAETQKLQIPQDLVSALGQHKPKTDYGIEALKPSFFGRLLEKLIGPKN
Ga0307510_10000006441F075326GAGMAIRLRRRPKPQPPVAVLGTYTFPTRTVQVVLMEDDRIQWICDCEKFRRWTTHKEPPWCKHIAKAAARRSIERLTRRVAVPRNAEH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.