NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307510_10000016

Scaffold Ga0307510_10000016


Overview

Basic Information
Taxon OID3300033180 Open in IMG/M
Scaffold IDGa0307510_10000016 Open in IMG/M
Source Dataset NamePopulus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)206932
Total Scaffold Genes175 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)135 (77.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)45.654Long. (o)-122.839Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044005Metagenome / Metatranscriptome155Y
F047908Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0307510_1000001636F044005AGGMDDITEASQPAQASQPAQASQPLGTAGTRKPIGLIVLLLLALAAAGWLGFYAQQLVDERARIRVDLAVQERKILDLREQLTRAEVAIQEKDAALATRDSALADATQPELPVRVSFRPAWMGQGMVASFRNVASQQLTLMVEFRDSNLKSSRDFALVVDAGSTAEVGHPQGWLVSSGQSVRVSASGFKSVTAFAP
Ga0307510_1000001638F047908AGGAGMELEDALNLGLPPHHVSQCSKGERVAFRVEILGYPQCTGFGATADEAVRVARHLFTQLRDGQTAVAVTEMEGDSAERLREAMRFVVTRALV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.