NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316605_10084108

Scaffold Ga0316605_10084108


Overview

Basic Information
Taxon OID3300033408 Open in IMG/M
Scaffold IDGa0316605_10084108 Open in IMG/M
Source Dataset NameWetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2398
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Soil Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Ohio
CoordinatesLat. (o)41.3777Long. (o)-82.5117Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042409Metagenome / Metatranscriptome158Y
F056711Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0316605_100841082F042409AGAAGGVGKLASHIDPQSKRILMLLALIPLLFSSCGGGYAAHRKSQNEWLNSNIGIATLDDLISGMGPPQQSIETPEGIWYTWRKVNSGAVSGGVSMGFFGVGMTTPTETGEELNCLFDRNTGKLRNYKYREW
Ga0316605_100841083F056711GAGGMRKLFPLLAAAMFALSIAAGGCSKEKSPPTQPSRKSISGTEKNAAPKPHVKFFTGTIEGLDAAGGTLILKGPRGERRFRVHEDVKDQIDGLNIGDKVIVKHTDEMALSIVKPGANKNPQTGNQTSKEKESAVK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.