Scaffold Ga0310810_10001309

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0310810_10001309

Scaffold Ga0310810_10001309

Overview

Basic Information
Taxon OID	3300033412 Open in IMG/M
Scaffold ID	Ga0310810_10001309 Open in IMG/M
Source Dataset Name	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	25898
Total Scaffold Genes	29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	23 (79.31%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States

Source Dataset Sampling Location
Location Name	USA: North Carolina
Coordinates	Lat. (^o)	36.0	Long. (^o)	-78.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018096	Metagenome / Metatranscriptome	237	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310810_1000130928	F018096	N/A	MDAVKIILPTAERKPCVCGAILSIHRSSSAGRELWLCSRHCGARGFSYEGALRRKIRLDLLSWGDLRRSAQTLIAAHTDTRSTFLVQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.