NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214471_10114690

Scaffold Ga0214471_10114690


Overview

Basic Information
Taxon OID3300033417 Open in IMG/M
Scaffold IDGa0214471_10114690 Open in IMG/M
Source Dataset NameSoil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2219
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil → Soil Microbial Communities From Uranium-Contaminated Sites Across The Upper Colorado River Basin Region

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)42.9888Long. (o)-108.3994Alt. (m)Depth (m)155
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021438Metagenome / Metatranscriptome219Y
F046231Metagenome / Metatranscriptome151Y
F064480Metagenome / Metatranscriptome128Y

Sequences

Protein IDFamilyRBSSequence
Ga0214471_101146903F064480AGGAGMSSTTDHVHEGHDQTPPTSADARGPDGTMDAPPETEASFEEIER
Ga0214471_101146904F046231AGGAMRMGRAHPSIVMDVQVLVTHAASVAAMEREMGHPPRIIRAPDVCYLFQARDAERLPALVERWESYGIAAQVVQIPPTDGPLTRDCPPIP
Ga0214471_101146905F021438AGGAGGMKPMKTPTQLRLTQDLLERADALIEVMAADPEVRALGMPTRTAVLRLAIARGLRDLERQYQRPTPTHAPAPRAATTPHDATPHSREGSLSHVYAGRDGEDQEPGAPRNGSGVSAPAPKGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.