NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326726_10001002

Scaffold Ga0326726_10001002


Overview

Basic Information
Taxon OID3300033433 Open in IMG/M
Scaffold IDGa0326726_10001002 Open in IMG/M
Source Dataset NameLab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)26201
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)24 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.3286Long. (o)-76.4792Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004508Metagenome / Metatranscriptome435Y
F020228Metagenome / Metatranscriptome225Y
F079500Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0326726_1000100226F020228GGAGGMLCAELERMEAEFDDILTALENPHLTEQEKRSLQDAYSRLSHSIKDHQSSGHEGHPCFEE
Ga0326726_1000100227F079500GGAGGMKTLLHFRETHDSYFHPHPLHTVFSLVISFVLALLAVLILTVSAK
Ga0326726_100010025F004508AGGAGGMRQIRLVGLFISISVVMLCVFAVAGQNQFGVADTYTVSFPENVRVANALLPQGNYEVRHVMEGQDHIMVFHQIGARKPVEVRAKCTLVPLAEKAKGDQKIYLTNAANEWVLQELIFKGDSAKHVF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.