Scaffold Ga0326726_10045448

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0326726_10045448

Scaffold Ga0326726_10045448

Overview

Basic Information
Taxon OID	3300033433 Open in IMG/M
Scaffold ID	Ga0326726_10045448 Open in IMG/M
Source Dataset Name	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3838
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (85.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location Name	USA: New York
Coordinates	Lat. (^o)	42.3286	Long. (^o)	-76.4792	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056799	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326726_100454487	F056799	N/A	LVTHLQNAPHWLLQGFRALFMGVSVAIGYVIYRKYLIEMQTRSEKYAEIRAQIRRLLADLLTVSDEELIRQLQRTIQRIEQLLKRYDPEAAHGGAEPKKPKVA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.