NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310811_11151367

Scaffold Ga0310811_11151367


Overview

Basic Information
Taxon OID3300033475 Open in IMG/M
Scaffold IDGa0310811_11151367 Open in IMG/M
Source Dataset NameSoil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)648
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)36.0Long. (o)-78.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031283Metagenome / Metatranscriptome183Y
F059212Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0310811_111513671F031283N/ADPEYVAYKMEPTGTQFLKGVTATQLLNTTTLSGSPLRSQLYAAYIADDSLSLSGKVPVLEVEPGTTIFSVLSPLLPQAHVWTIRHFSRYMLASG
Ga0310811_111513672F059212N/AMGSPMIRSRFVRTFALVLATTVALSCSDYSPTAPSVPIAAPTQAENGLIGDLLGVVTNLLGSVLKVIGFQTDPNGIPVTAVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.