NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326762_1000539

Scaffold Ga0326762_1000539


Overview

Basic Information
Taxon OID3300033491 Open in IMG/M
Scaffold IDGa0326762_1000539 Open in IMG/M
Source Dataset NameHot spring sediment microbial communities from Norris Geyser Basin, Yellowstone National Park, WY, United States - NOR.PS_S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16737
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (29.41%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.7265Long. (o)-110.7091Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038745Metagenome / Metatranscriptome165Y
F051572Metagenome / Metatranscriptome144N

Sequences

Protein IDFamilyRBSSequence
Ga0326762_100053916F051572GAGGMSRGRAYGGPFAEVWAFADVVLKGGCKKSPQFLDAHLELCVLAALVKAAPAGSMVRLRPEIVRRLVEELAAAAGQDRERIRNALLKKAGETLAQLRRELGDKAPAEALLAKLVELFLKELEA
Ga0326762_100053917F038745N/AMDKAVVVVCGELMQISLAFSAYYPLCLGGPPCAYAEAVERLIRRAASARGAEELLEAINGRVRLEELGLSAPALEDLAEELGPEPRWLDALAASFFRLYLGLGRRRRVDGRDLALALCLWAQKKRQEDPRNPLWRAAELEPDRLYTEEEAREALKINEALFRRLWRRALAGDKAYGFQLILAALSLMAAPPRSA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.