NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316628_100101113

Scaffold Ga0316628_100101113


Overview

Basic Information
Taxon OID3300033513 Open in IMG/M
Scaffold IDGa0316628_100101113 Open in IMG/M
Source Dataset NameWetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3232
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Microbial Communities From Old Woman Creek Delta, Ohio, Usa

Source Dataset Sampling Location
Location NameUSA: Ohio
CoordinatesLat. (o)41.3769Long. (o)-82.5097Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020982Metagenome / Metatranscriptome221N
F041239Metagenome / Metatranscriptome160N
F064925Metagenome / Metatranscriptome128Y

Sequences

Protein IDFamilyRBSSequence
Ga0316628_1001011133F064925GGAGMLGEELARCHVGAMLRGQPGRYYCARCLAGLVEAVAWTKRDARRAIAVLFRWPIGLTITMRRRRPCRGCGEVSGARLGAARLAAGSEPA
Ga0316628_1001011135F020982GGAGGMMPRRHFMGDRTYRGVTYTLQLEAVEDCVFKAHARLLPSGPEVSFVDEASDRALQQAEAEIKQIIERREARAVVRERLPERKYGDVTYTIIVRTEATRVVTELYFIRANAVQRRPGPGTFFGLFPGRTKERAIAQAEKSFKAKIDKERADGRGRKD
Ga0316628_1001011136F041239GAGMRAPGLGLSVWWDERDYRACGASLECRGRFIVGKLFDLDTRMLQAAWLAAFGRRLLGPPEIQAHDITRSQWGLILSHMGASPDEIADVQARMGRT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.