NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247829_10543027

Scaffold Ga0247829_10543027


Overview

Basic Information
Taxon OID3300033550 Open in IMG/M
Scaffold IDGa0247829_10543027 Open in IMG/M
Source Dataset NameSoil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)964
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.673Long. (o)-77.032Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003507Metagenome / Metatranscriptome482Y
F006941Metagenome / Metatranscriptome361Y

Sequences

Protein IDFamilyRBSSequence
Ga0247829_105430271F006941AGGLHLIEHISEQCTIPATRLKPPAHALHQTLQKVMRSFGRQCRGQGKVFVTLVRQTERQLLDLGSAMENWAQDATELLHQETHLPEVQRERLRRDLEAASDAHRHIAKQSQRLTQGKKLAQCKIVHAYDPTIAPIMKGKSNCPAQFGRKTGLLSEPASGFIFANRVPHGNPSDPSYVLPMLDKVQQAIDLVASPQRLRVYSLGGDLGGNDAALHHALHGRGILTVGIPTTVEPINPTP
Ga0247829_105430272F003507N/AMYACGLREVQADHAQAHFVLPETLAQFRRRMDQDLMDDLVAIQAAAAMEEGLVSPAHLLVDTFPSEQGSQRVPDATTLYKAQKKSCTSSSTSVSSARSRPRD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.