Scaffold Ga0326734_1000003

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0326734_1000003

Scaffold Ga0326734_1000003

Overview

Basic Information
Taxon OID	3300033552 Open in IMG/M
Scaffold ID	Ga0326734_1000003 Open in IMG/M
Source Dataset Name	Glacier ice microbial communities from Ngari, Tibet, China - 15_GP2_131.5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	92043
Total Scaffold Genes	116 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	14 (12.07%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacier → Ice → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location Name	China: Ngari, Tibet
Coordinates	Lat. (^o)	35.2833	Long. (^o)	81.4833	Alt. (m)		Depth (m)	131
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048842	Metagenome / Metatranscriptome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326734_100000371	F048842	N/A	MKKSITVILITFLLSAAALIGEVCCIYKMCTCNWEPIGKAEIFYTVGTFTGAGCIIGYINIEDK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.