Basic Information | |
---|---|
Taxon OID | 3300033552 Open in IMG/M |
Scaffold ID | Ga0326734_1004721 Open in IMG/M |
Source Dataset Name | Glacier ice microbial communities from Ngari, Tibet, China - 15_GP2_131.5 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3732 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Glacier → Ice → Extreme Environments Viral Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Ngari, Tibet | |||||||
Coordinates | Lat. (o) | 35.2833 | Long. (o) | 81.4833 | Alt. (m) | Depth (m) | 131 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F104558 | Metagenome / Metatranscriptome | 100 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0326734_10047212 | F104558 | GGAGG | VHAPAWPDEPAFHAADPRRRTSAELDLGATWRWAGSNDAWRLAWLRDTGELVLCRADGYDGTCTDVSVLVRLDHERDVDALLEGWQERRTDPDGLAWVLRRTGPLAA |
⦗Top⦘ |