NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326734_1015519

Scaffold Ga0326734_1015519


Overview

Basic Information
Taxon OID3300033552 Open in IMG/M
Scaffold IDGa0326734_1015519 Open in IMG/M
Source Dataset NameGlacier ice microbial communities from Ngari, Tibet, China - 15_GP2_131.5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2181
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (14.29%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacier → Ice → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameChina: Ngari, Tibet
CoordinatesLat. (o)35.2833Long. (o)81.4833Alt. (m)Depth (m)131
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058147Metagenome135Y

Sequences

Protein IDFamilyRBSSequence
Ga0326734_10155193F058147N/AMNRQNIIVFIKGERVETYGNLKKCCEAEGLKYWTLSRLSFPIRLDNVIIHKTLFK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.