Basic Information | |
---|---|
Taxon OID | 3300033572 Open in IMG/M |
Scaffold ID | Ga0307390_10688602 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 641 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | -55.8778 | Long. (o) | 1.056 | Alt. (m) | Depth (m) | 24 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F079557 | Metatranscriptome | 115 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307390_106886021 | F079557 | N/A | EWYDKMQNALGNTPLSQLPKQIEAMYAPKTNVPVPWRQKADGKTFNDQYPTEHRQSSIPGAGLGWWAVKDIPAGTRLRRVSLEDGTLTKFRNEEDLRATGWDVSDACNYGIGHWKDPSCIYWLVPGTSVNHADKTRKTTIIYKHLDGAYELWSDADIKAGEEMFCDYERDYAPCEWYDKMQNALGNTPLSQLPKQIEAMYAPKTNVPVPWRQK |
⦗Top⦘ |