NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0371489_0029133

Scaffold Ga0371489_0029133


Overview

Basic Information
Taxon OID3300033755 Open in IMG/M
Scaffold IDGa0371489_0029133 Open in IMG/M
Source Dataset NameLab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4146
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location NameUSA: McLean, Ithaca, New York
CoordinatesLat. (o)42.5488Long. (o)-76.2662Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001080Metagenome / Metatranscriptome785Y
F091340Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0371489_0029133_3288_3569F001080N/AMLARAQALRRHFLEHCSWEEATPTLKDPDRVPDPSTVRRWSRGMDRSQPAASFRRQTFARLAHWLGRSAPADPQAEPLWGLTPVLQVLWPLRL
Ga0371489_0029133_3525_3920F091340N/AVLQKVSAECLSASQQAVVGVGERERGKQGEGFPATKAKAASDPNPVVMFIVRLLAATTVADDGIAFTSRASPQHDVLAVASPVGFELVRRGRKWDKENRSSWGLPLGVDLPRSEPEAGPLLLKKKIPPGEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.