NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314867_012240

Scaffold Ga0314867_012240


Overview

Basic Information
Taxon OID3300033808 Open in IMG/M
Scaffold IDGa0314867_012240 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2018
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NamePeru: Loreto
CoordinatesLat. (o)-6.3272Long. (o)-74.8136Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016370Metagenome / Metatranscriptome247Y

Sequences

Protein IDFamilyRBSSequence
Ga0314867_012240_835_1515F016370GGAGMGKPAFRKMVSCVLLILFPGAMWAADSNAAMLYTNGAAWVNGAHVPRSASSIFSGDLLQTRSDSVANINQPGSSITVMSDSLVKYEGMSVDIEHGGVTVSTSRGVATTAGDVKVTPASYSWTEFNVVDVDGTVRISARKGDLTVTDGKDVVTLAQGQETTRAEQSGDDQDNTTTAKKRKRRSGAAPAAGGGIMNSPIAIGIGAGAIAGVTTWVLIKNDNPASPTKP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.