NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0364926_116392

Scaffold Ga0364926_116392


Overview

Basic Information
Taxon OID3300033812 Open in IMG/M
Scaffold IDGa0364926_116392 Open in IMG/M
Source Dataset NameSediment microbial communities from East River floodplain, Colorado, United States - 65_j17
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)559
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment → Sediment Microbial Communities From Colorado River Basin Floodplains, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9229Long. (o)-106.9499Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043144Metagenome / Metatranscriptome157Y

Sequences

Protein IDFamilyRBSSequence
Ga0364926_116392_182_559F043144N/ALSNLRELITSRFRNGRTKSTVNKEEFEMNMFSRVSRLREKISETYWSFMIRNPRGYITATARVGVISLILLFVPEASAQLETQVTDALNPLARLLVGPVAKGLAIIGLFAFVGLLYAGRWMMAVSS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.