NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334980_0015070

Scaffold Ga0334980_0015070


Overview

Basic Information
Taxon OID3300033816 Open in IMG/M
Scaffold IDGa0334980_0015070 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3331
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012108Metagenome / Metatranscriptome283Y
F043359Metagenome / Metatranscriptome156Y
F055724Metagenome / Metatranscriptome138Y
F059898Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0334980_0015070_1067_1240F059898AGGMTEDREKAMIYIINFFNSRMGAMSKNNVDKAKELISTHEIAASELVDKYVRLVYENS
Ga0334980_0015070_2057_2434F012108AGGMINLQLTVREAMWILSKLESYDTIHDKIVNAFEIALGVNQRRMVTITGGMTLDNRIPCIKAVRLHSGWGLKEAKDWTDVLVGGWKYDKWYPAADGTKHSITLNTPEAAENLLRDLTGLGCEGYLS
Ga0334980_0015070_3181_3330F055724AGGAGMKTADGNDKLGKGCIVVSRPVGDTCPPDCDYLNNGCYAEATENQYKNARV
Ga0334980_0015070_757_1074F043359GGAGMEWFNSHKNPPAVGQRVYYFGPNIGIGIGHYSYHPDRKIETYYYNENNEKVVDKEIEICQHVFTNQAKPWTCDACDAPFWLPYDEERAKSWCPIIPEEYTRGLYD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.