Scaffold Ga0373875_001921

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0373875_001921

Scaffold Ga0373875_001921

Overview

Basic Information
Taxon OID	3300033817 Open in IMG/M
Scaffold ID	Ga0373875_001921 Open in IMG/M
Source Dataset Name	Laboratory-enriched microbial communities from a contaminated site in Ontario, Canada - KB1_TCB MSP
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7844
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Persistent Organic Pollutants (Pop) → Unclassified → Unclassified → Anaerobic Enrichment Culture → Metagenomes From 1,2,4-Trichlorobenzene Dechlorinating Enrichment Cultures

Source Dataset Sampling Location
Location Name	University of Toronto, Ontario, Canada
Coordinates	Lat. (^o)	43.65699737	Long. (^o)	-79.3957	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083634	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0373875_001921_1662_1976	F083634	GGA	MYIMLKMADQTISLDRIRIGGRVCRLARKLIVTIEHEDDRLTLSNEEFGLVVSAETLEEGIAGLSEELATLWEVYVDEDPANLTADALRLRSNLTSLVPAGVSL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.