NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326764_015985

Scaffold Ga0326764_015985


Overview

Basic Information
Taxon OID3300033830 Open in IMG/M
Scaffold IDGa0326764_015985 Open in IMG/M
Source Dataset NameHot spring sediment microbial communities from Norris Geyser Basin, Yellowstone National Park, WY, United States - NOR.RB_S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1229
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.7265Long. (o)-110.709Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052042Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0326764_015985_1_1227F052042N/AYIPNYGYVNYAGNPSTITLNFTGTPELKQLHMIYDMLDDTVLMYFSITVPNWNPATKAQYVYKFPVSLLKSQQSINQYAVSGLTPTTTSTPPPNDKPYFLGGLKFDSTVEQTIASANGGNWGNTLQMQSAPQFAISFDWYKLGGFMGYKPSNGFLPAIYVGNSLYMWAYNYPHGDSLMAIAFADIHKNPAQPQTYYQPIITNYGYAFPAWIGLPENLESCPSSYGSNSYYCIPILGFAGQLDTFDLGLNIDKFGSIVPGESFGIHGAYVIPITLPPRPDWGGISSIRMKVLYVAPIFHQFQGYGGLSFAWTRDSVEIPYYPEMGTCRPYLTTLPDGKLKVTMGGYHADSYIDGIAIYMDKSAISPKGKTLVTVPSLIFGQTSPGGSYYVIAGANPFNSIYHGVVAYTFG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.