NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334790_001542

Scaffold Ga0334790_001542


Overview

Basic Information
Taxon OID3300033887 Open in IMG/M
Scaffold IDGa0334790_001542 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19259
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (58.62%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3534Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002015Metagenome / Metatranscriptome604Y
F002290Metagenome / Metatranscriptome574Y

Sequences

Protein IDFamilyRBSSequence
Ga0334790_001542_13723_13992F002290GGAGLFAYPPEADSSMRKDLCAESPSVSHNDSDWLGVYRAAAMEFDRDKLPASIEVAEKAIHQRLRGLPIAHSKEHRKLKEALNSLAVLKRML
Ga0334790_001542_2881_3033F002015GGAGMTTGVRISYLCDARQMRCYPVSTRINHVANDDEGCSAPVELAEIQNRLFS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.