NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334792_005874

Scaffold Ga0334792_005874


Overview

Basic Information
Taxon OID3300033888 Open in IMG/M
Scaffold IDGa0334792_005874 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5413
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3534Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004490Metagenome / Metatranscriptome436Y
F006325Metagenome / Metatranscriptome376Y
F059709Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0334792_005874_2591_2785F004490GGAGMECQTKDELEQHLSDIRRLATSRALTSEEKDAAARAERFAIGLLREHDQSGHHGKRCPFATRCE
Ga0334792_005874_2971_3411F059709GGAGGLKKPDILQVCQAGSFLLCASLAWQVTSGYDGTEFSGGWLTGSLLSMEDIGTALFIVAIALTFVFPRVAAAIGLAASVLCFPLYFLFIAPVPFAQVFARGHEFKVQPVPGFHWDIWPVVGLFALAVTLYFCIRCLATTGRKQIPQRA
Ga0334792_005874_3689_3898F006325N/AMGTYTPPRREHMTNPTTDPAAYTDQELKQALARVLALARSERLNDAEVQNFWQLYEEIVRRRAAAGTAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.