NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314861_0000221

Scaffold Ga0314861_0000221


Overview

Basic Information
Taxon OID3300033977 Open in IMG/M
Scaffold IDGa0314861_0000221 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)98825
Total Scaffold Genes100 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)59 (59.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NamePeru: Loreto
CoordinatesLat. (o)-4.0712Long. (o)-73.2029Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007851Metagenome / Metatranscriptome343Y
F008989Metagenome / Metatranscriptome324N
F042692Metagenome / Metatranscriptome157Y

Sequences

Protein IDFamilyRBSSequence
Ga0314861_0000221_75527_75961F007851GGAMLITAIKILIVIVLGFLFAYIYGLIEHGYIPPAEHLRLRFFNHFANYHITMFALFSALPIVVLVFLPNLLGVLVSLGLWTYLPFGEDIAWYHFSGTWPAPEDWTSWGGGYHIAGRWVPRWYLASAIVATLFYALAVSLALSRYP
Ga0314861_0000221_93262_93483F042692AGGLDLRRKIDGIDVIANDNEIWFLQESRICWTTTEEVWSGSSRLGEMLHQRGYRVQPKRFPKKLRELILTISKSP
Ga0314861_0000221_98060_98470F008989GAGMSNNAVLIRGLDRDTYNSVVAKAKQQGKNVGDLVNEALRQYMDQSPTESPDVFDTKKLVIAGSVLLSKSDILGLHKELGNFHLENSGELTFDKDVDREAFQKIERINNTGKLRVPSDVHHFALLKAGHVRGEVEKY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.