NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0371487_0217978

Scaffold Ga0371487_0217978


Overview

Basic Information
Taxon OID3300033982 Open in IMG/M
Scaffold IDGa0371487_0217978 Open in IMG/M
Source Dataset NameLab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)901
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location NameUSA: McLean, Ithaca, New York
CoordinatesLat. (o)42.5488Long. (o)-76.2662Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011432Metagenome / Metatranscriptome291Y
F024853Metagenome / Metatranscriptome204Y

Sequences

Protein IDFamilyRBSSequence
Ga0371487_0217978_1_720F024853N/ALGGFSDAHFYDPTNTLIDSDEVTIEGGYSRLLLRHDQIGAIYAFQLFQFPQVTGGQIYIHIVNLRWSHTISGRLRLVAGAGPEYIDLEQGSNITHWSWSARVQLQYKMGRASLVASYEKFTSAGSGFYAGANTQAARLGYIRPLGRTWVFYGALDYSHNTKLQSTLLGLGVSAASYDEGSAGAILRKHLGRTYDFFASYRFSEVGFSSPVTVGGSTGRISERQVGAIGVEWHPRPTRIE
Ga0371487_0217978_759_899F011432GGAMSDRELTMDDYLAMLLRRLRVILIPALMAPLAGFLVSYVFPPKYTSQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.