NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334992_0005154

Scaffold Ga0334992_0005154


Overview

Basic Information
Taxon OID3300033992 Open in IMG/M
Scaffold IDGa0334992_0005154 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9378
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)24 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006385Metagenome / Metatranscriptome374Y
F051126Metagenome / Metatranscriptome144Y
F071231Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0334992_0005154_4938_5090F006385GGAGMILDNGTLIAIVIALAGSLTMMIAFWQRNIQLEKEIRRLQVALRSERIKK
Ga0334992_0005154_5087_5287F071231AGGTGGMMTRKDYVATAQILSNYFATSVFDEQGEILFADLVDEFSLMFETDNERFDANRFAIACYKELEMSK
Ga0334992_0005154_5652_5861F051126AGGMSVKPYSIEDLLIGKTYRSHNRHDEGVIQYATPRPDVWYGSEFEAYAIEVRSTRGIKNFWATVAVKVGG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.