NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310131_080028

Scaffold Ga0310131_080028


Overview

Basic Information
Taxon OID3300033997 Open in IMG/M
Scaffold IDGa0310131_080028 Open in IMG/M
Source Dataset NameFracking water microbial communities from deep shales in Oklahoma, United States - MC-FT7-sol
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)618
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Oklahoma
CoordinatesLat. (o)35.784Long. (o)-98.26Alt. (m)Depth (m)2896
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004115Metagenome / Metatranscriptome452Y
F056187Metagenome / Metatranscriptome138N

Sequences

Protein IDFamilyRBSSequence
Ga0310131_080028_23_367F004115N/ALDTPLSWVDADFLLQKIGTTLSLTRNHNKNQYCDYCKYRWGQNKGVWDIRATTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP
Ga0310131_080028_351_617F056187GAGMSNYLDDYVSVQDRLKEFINAYPDYRIKTHILAESLVANCDVYIIKTELYRTEADAHPWTTGLSSESKSKQYALELAETGSLGRALNLA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.