NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334920_000567

Scaffold Ga0334920_000567


Overview

Basic Information
Taxon OID3300034002 Open in IMG/M
Scaffold IDGa0334920_000567 Open in IMG/M
Source Dataset NameBiocrust microbial communities from Mojave Desert, California, United States - 16HMC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15457
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (57.89%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.3778Long. (o)-117.6098Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009385Metagenome / Metatranscriptome318Y

Sequences

Protein IDFamilyRBSSequence
Ga0334920_000567_11749_12015F009385AGGAGMFILKERQQLERAIEKAKKIRPKVHFVTFGHYQVSGSKGYYTVICKKSDNGYKLVDCTCKGAEKGLVCYHSVAALSLHIGLARLRQIA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.