NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334926_006878

Scaffold Ga0334926_006878


Overview

Basic Information
Taxon OID3300034004 Open in IMG/M
Scaffold IDGa0334926_006878 Open in IMG/M
Source Dataset NameBiocrust microbial communities from Mojave Desert, California, United States - 22HNC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2423
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.3778Long. (o)-117.6098Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005661Metagenome / Metatranscriptome393Y
F006886Metagenome / Metatranscriptome362Y

Sequences

Protein IDFamilyRBSSequence
Ga0334926_006878_1143_1820F005661GAGGMNLNYRVGKTSGAAQVAREFGYDPEQYGNLTPELVHDAARQAKVTDLQKQLATALNRHVAKIRANKVEIERLTLEAIESGLTDKAQIDKYVSQAIIAGAKHDYHLVNLQQKLQHELNLVKVQGASTQTLQNMDFRQRLLLIKANHTAKGQIQTNGFQQSLKAIQASPQQAIAMQAKRSAFNAYINAKDFDPIPATAGGSGGGNSPIANTGKGFLGGLFDFFTGKN
Ga0334926_006878_1861_2328F006886N/AMYSEFDASEFDYLNSATPQHFEQQNQTQTPEVTDIERFWKITGNWGEFGGYFSTGLAASLIVRAIPVTIPAGVIFFPAISLGVGLYSLSAEGRDKTRCQLILLAIRTALLSANWDAWLAWVIANSQLLIFSFVVTVITVAFVGVQVWSKLSNAGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.