NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334985_0101715

Scaffold Ga0334985_0101715


Overview

Basic Information
Taxon OID3300034018 Open in IMG/M
Scaffold IDGa0334985_0101715 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2032
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000714Metagenome / Metatranscriptome924Y
F031384Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0334985_0101715_1891_2031F031384AGGAMPNWVMNGLTIEGNPEQVKSLMEQMNKPFKMVHDSWNMETHQQEKKL
Ga0334985_0101715_97_621F000714N/AVEHATIPYTDSPLPTKEEQMEEATIGSDATHSPAVEYNPNQLVTYKIIHGYSDPEYATTKVASLEWDLHNARQTQKTNGSLTNKISLVKDIITEAYADSDDQETLRSIAEALDIELTRTVEWSATIEVSGTIELDLLADSDTDIESEIYDNLYVESQHGNIQVDDTEVTNVREN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.