NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335023_0009807

Scaffold Ga0335023_0009807


Overview

Basic Information
Taxon OID3300034050 Open in IMG/M
Scaffold IDGa0335023_0009807 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5601
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001143Metagenome / Metatranscriptome766Y
F073554Metagenome / Metatranscriptome120N
F074881Metagenome / Metatranscriptome119Y
F088893Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0335023_0009807_2167_2313F001143GGAGGMSSWLIAVVGVVYTIVAIDLIVKGNTGLGIAFVGYALGNVGLYMEAAK
Ga0335023_0009807_4380_4556F088893N/AMKHIDKNQILFNVEGETFKVKIGENLDLEEVYTVLLSALVYLEDLASGNTAHPSQELH
Ga0335023_0009807_4570_4740F074881GAGGMVFDVDTNEAAFIVRVIGQLPTESGAFPLHQKLVAQFQEQEKQSATEPLVTDVTAK
Ga0335023_0009807_84_293F073554AGGAMSIGMYGIDDEDVDMDLVQYECWYWSVIDSMAELVMNNGRDKVMSHVSEAVLNKVHNGYVTAQEDPFKW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.