NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335019_0194042

Scaffold Ga0335019_0194042


Overview

Basic Information
Taxon OID3300034066 Open in IMG/M
Scaffold IDGa0335019_0194042 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1317
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023344Metagenome / Metatranscriptome210Y
F047059Metagenome / Metatranscriptome150Y
F049617Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0335019_0194042_206_382F047059GGAMKIHKISLEQDLEDARNNIPISEDEYFESDSYYMGAIDTMEHILSVASDIMNDNERIY
Ga0335019_0194042_3_206F049617AGGAMNSEDIGLPPHLQRLVNAGVSGLDIMHGELKNLMLIAEQELADAIEREEESEEAMDSMVRTECEGYLD
Ga0335019_0194042_578_790F023344AGGCGGMEAFTDTVGEHILGAIQVEIEQALFEDWNNANLDEGEAFAEYKFMQFAPDNLKQSYNEYYGYIEGDEFCL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.