NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310127_001364

Scaffold Ga0310127_001364


Overview

Basic Information
Taxon OID3300034072 Open in IMG/M
Scaffold IDGa0310127_001364 Open in IMG/M
Source Dataset NameFracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)28019
Total Scaffold Genes46 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)31 (67.39%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Oklahoma
CoordinatesLat. (o)35.784Long. (o)-98.26Alt. (m)Depth (m)2896
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029722Metagenome / Metatranscriptome187Y
F034912Metagenome / Metatranscriptome173N
F088819Metagenome / Metatranscriptome109N
F099212Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0310127_001364_19029_19415F088819GGTGGMNARYIKPEELRKIWPFVRAGLEVILKKSPEQWIPEDIYADCFAGRSLLWMYFEDSYPCGFVVLQPIGDNLHIWCAYGKGDFDAGMDHVLVLARENGARTISFDSWRKGWDRKAKALGFRPRKWVREV
Ga0310127_001364_25126_25362F099212GAGMTQRWERAKALLGDEFLTEIFTELEKDNIERIINSNPDDIDLREESYVAIRAVRQVKARLESVAAEGEIVKRRFKIFK
Ga0310127_001364_4169_4408F029722AGGAVASWINLIKQVKSSDVEEIAAAYEKALPFVVQDWAKMILKLPRTKRLPIIEKIDRVHGDKIGQMVRDEVTAQHISKRNL
Ga0310127_001364_6237_6503F034912N/AMKHNLPIVKVVWEDACHDTLGWGDSPEKAREFQVPLVVSVGFLIAETKQGVKICQSLTDDAIAQSLVIPRKMIQSIERGAWREKKVRG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.