NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326724_0000362

Scaffold Ga0326724_0000362


Overview

Basic Information
Taxon OID3300034091 Open in IMG/M
Scaffold IDGa0326724_0000362 Open in IMG/M
Source Dataset NamePeat soil microbial communities from McLean, Ithaca, NY, United States - MB00N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)104364
Total Scaffold Genes115 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)81 (70.43%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.5488Long. (o)-76.2662Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002289Metagenome / Metatranscriptome574Y
F010341Metagenome / Metatranscriptome305Y

Sequences

Protein IDFamilyRBSSequence
Ga0326724_0000362_70137_70361F010341N/AMTDPLTVKPVYKTLSQYISNRSDIGAGKAMRDGVLEPSNPFERKAARPPRRWFVLFSLVSALFFGCFNYFNNLL
Ga0326724_0000362_85895_86260F002289GGAMMIEPLVQVDPGADLQSAMAALVKVTETVEIVRWIEFPASVLLFLLVPGDPGSGAVYVLDRKKGTWYAVDFEDEQFGGYSVSQLETLLKECNFLDLIERPGLWRAGLQWVVLPGMVPEAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.