Scaffold Ga0326724_0012656

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0326724_0012656

Scaffold Ga0326724_0012656

Overview

Basic Information
Taxon OID	3300034091 Open in IMG/M
Scaffold ID	Ga0326724_0012656 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8387
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location Name	USA: New York
Coordinates	Lat. (^o)	42.5488	Long. (^o)	-76.2662	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093110	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326724_0012656_4542_4745	F093110	GGAG	MTVTMTNRSHRVACMVLLLLVAVALTSALVLAGERSWGSEKKQVSERIPASTQITDVRAESTGWPCV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.