NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335027_0000081

Scaffold Ga0335027_0000081


Overview

Basic Information
Taxon OID3300034101 Open in IMG/M
Scaffold IDGa0335027_0000081 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)85870
Total Scaffold Genes115 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)86 (74.78%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001280Metagenome / Metatranscriptome732Y
F013888Metagenome / Metatranscriptome267Y

Sequences

Protein IDFamilyRBSSequence
Ga0335027_0000081_1527_1676F001280GGCGGMCFECGCESVGSTTGIAPATVTDVSRDGEAGLTLNMTSTPEQTRQFINE
Ga0335027_0000081_25556_26218F013888GGAMSTIGVLPASGKASRIGGIPKFCLPISDERSLLQWHVEQMLEVCDEVRVSTRAEWVPIIQNMDMNIKLIVREPSTMSDAVKFMVGEYNDTVLIGMPDTYILNAPGNIYKPLFKDNTADLVLGIWECGESIKGRVGQVLVSNDKVIESEDKVDNCDYPDMWGTMLFRKNMIRYIDTSLDHPGKQLKEWIAKGANIRAVRPGGQYMDIGTLRGLKQLYKEME
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.