NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335029_0000080

Scaffold Ga0335029_0000080


Overview

Basic Information
Taxon OID3300034102 Open in IMG/M
Scaffold IDGa0335029_0000080 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)80189
Total Scaffold Genes98 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)71 (72.45%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065260Metagenome / Metatranscriptome128Y
F091944Metagenome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0335029_0000080_37427_38302F091944AGGAMAFTKTGVVTAPKIVPSAFGLLAVVKPENGPNEDQWIRGFSQEWETTLYSATNWDDSDSTDGEVVAAGTPTYYTEIKPFFIEAEELRSTLGFNGLDRIERLKRQIEGITQQAMEVELWDGAVRKGESHANVALSDASATILNGGTALSPRRAIAALEFAIGEASDGGEQGVIHLTRDVAALLASNSNMLFHEAGKEHLQTLGGTPVIVGSGYSGTGPDGATGATASATNKWIYATGTVKTYVGDVDVVNDNLAQAYDVSGNQNDMRLKAIRPAAVYFDTSIHLAIRVDLTA
Ga0335029_0000080_57064_57657F065260N/ALQEEEKKDKVLTTMTNTKYVKKNQQVPKHIADFFKATTDAPTRDYLIRELCYKHWTYEAVATACGITRERVRQIYTSEPVTGYMPIPFEIPEPPLRPERSKPVYIEPTPATLKRLLELQPYAQLVRSNGKAYREEAEEYTKLLNYAHTVEGVTLYRLAKRLGVTHGALRFRLVRYGYKKPVTATSKVYNPILKENRI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.