Scaffold Ga0335030_0014823

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0335030_0014823

Scaffold Ga0335030_0014823

Overview

Basic Information
Taxon OID	3300034103 Open in IMG/M
Scaffold ID	Ga0335030_0014823 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5962
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (81.82%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	43.0995	Long. (^o)	-89.4045	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025983	Metagenome / Metatranscriptome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0335030_0014823_5526_5804	F025983	AGGA	MKNESRSLNASLVDGATDGKYRKVRPNTTVAPGTGEDIMKANRSALNPYWNYDFIDQEAPSKVNPLGKSGDTAPKVSGNVADTYNNQMGANY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.