NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335037_0144710

Scaffold Ga0335037_0144710


Overview

Basic Information
Taxon OID3300034107 Open in IMG/M
Scaffold IDGa0335037_0144710 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1298
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045760Metagenome / Metatranscriptome152N
F078719Metagenome / Metatranscriptome116Y
F099303Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0335037_0144710_31_426F045760GGAGMASSGSKAKQAYAALYKSSTRWATNRKIKLTRVLKQQPNNEQIKDALANIKYRRHTPTTKTVWSHSNIRLAKLFKEFTGRASADLFSSNPKVQSAALTYRPNWDKFKAIEGKVNFSLGARAHDSKGNLVWK
Ga0335037_0144710_417_680F078719AGGMEVIEVYLLLALTTGITSCYLFLFPAVALARDQGVHNSFTENTWLSYLIYTAITTITAPFSVLPIFIPSFAERFKIGLERAVMESQT
Ga0335037_0144710_751_1023F099303N/AMNFIEFTYTKADGTESKRAVLPLVGPTTFVEGIDVSQMPEDEFVVFCRDFSALKSTQHEQTMAMLEQFDLKHNYRRFIPAQMSDITTDYV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.