NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335063_0002108

Scaffold Ga0335063_0002108


Overview

Basic Information
Taxon OID3300034111 Open in IMG/M
Scaffold IDGa0335063_0002108 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12454
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)22 (78.57%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000376Metagenome / Metatranscriptome1216Y
F011938Metagenome / Metatranscriptome285Y
F013878Metagenome / Metatranscriptome267Y

Sequences

Protein IDFamilyRBSSequence
Ga0335063_0002108_733_984F000376GGAMSIYQERAKECKCCGKHVPLPTVLKEYHGIIMCPTTFSNVVEYNRLWKSIGSRPMGSVRKHFSDYVQQVVETTIDKNEDGTIQ
Ga0335063_0002108_7771_7998F013878AGGAMLNLTELGVEVFIKKAKNLTPYWDNYDLVIWKKDSNGFTDIKGMFKENAWGTAEKIAVNSNGIWKLPAKYVKHFR
Ga0335063_0002108_8590_8787F011938GGAGGVKEYYDTTHIVFIHAEQICGVVEKLGAWASIVTFTKDKVEYKELMENEEFTIINEIVFKHIEESD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.