NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335063_0011956

Scaffold Ga0335063_0011956


Overview

Basic Information
Taxon OID3300034111 Open in IMG/M
Scaffold IDGa0335063_0011956 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5575
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (76.47%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003603Metagenome / Metatranscriptome477Y
F006846Metagenome / Metatranscriptome363Y
F020166Metagenome / Metatranscriptome225Y

Sequences

Protein IDFamilyRBSSequence
Ga0335063_0011956_2285_2398F020166AGGMPAEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDEDVN
Ga0335063_0011956_2388_2669F006846AGGAMLIEFVERYLMRPKRLREAIKAVVHENDELLRMLKQYEEDDTPTNLTWAEGDTWYGWTYNSNAKRYYFDDIGNTSLIGLWESQWAREAEAESK
Ga0335063_0011956_5076_5492F003603AGGCGGMKSKEHQVGELLANSVEDHFFNPAALGRYLAEQPIYTLDRVIEVVAWVIEKQARRYEREYNNGGTVSEGLALSYKLDQVIDKIKLKNDFNNIKLPPTKQEQAEYVKAMPKVEEQSYRYSYLHETNNGPNATLNVQAVI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.