NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335068_0000462

Scaffold Ga0335068_0000462


Overview

Basic Information
Taxon OID3300034116 Open in IMG/M
Scaffold IDGa0335068_0000462 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)31936
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (68.97%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043934Metagenome155N
F051128Metagenome / Metatranscriptome144N
F101152Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0335068_0000462_28077_28580F043934AGGAGMPITDVSTVSEDALSLKVFLDKVLEKTIKVFEENNVPLPSRRFWTVGEPAIDCEQLVVSFMQMYLGTPGDQAGTPQRCTMPRSAVLTISISREIPVVGQNGKAPTGEKIQEGSEAAVVDAWMFMRLLNRLDQWEPDEFGMGVIATADSSGFDGGFQTTAMQLTMVVP
Ga0335068_0000462_3956_4330F101152AGGAVYELNDSLLCAEHYRDKTRLIKRATPCDKCGADNAVRDPSHRRNEYLCWSCHQENGFVVNDSVIKRAIVSLVNNFTRGTKIKCDAAGYGSDCDNNIKPRGPWGGRALCDKHGKTPPKPQKGTKS
Ga0335068_0000462_6566_7057F051128AGGMAHTPELPKSEAELLASLSKEQLWRRVKDLNDAGWTLQSIADAFDPPRRRSTVRSWVIKDTPECVFVTATPTPPKPKQKLRRKRPPSPGIPVDQQLQIARLSPLARRYRARTNPGSASFTANTQLTVIAGELYLKGVTVSELARASGVTYRAMKRRVDRANSQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.