NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335068_0380169

Scaffold Ga0335068_0380169


Overview

Basic Information
Taxon OID3300034116 Open in IMG/M
Scaffold IDGa0335068_0380169 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)680
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001229Metagenome / Metatranscriptome741Y
F056605Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0335068_0380169_1_360F001229N/AMNLDVYRQSEIQDPDTGAIVREWNFYKTVPCHVKGVISNSATTRSSDKQIFSNKYLNDQVVQVRTSEKLTAREKVTNIRDSEGNTIWNEINYPNETPTVFEVMGTTPVTDPFGRVIAYNS
Ga0335068_0380169_390_680F056605N/APPSIHDYSGIFQSGIPYKVQARFGWASVPENVEQAAAELMKDYFSKDTMWRNKYVKNISTFDWDFEYTGDAYTGTGNAYADNLLADYVLTAKAEII
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.