NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0370483_0000859

Scaffold Ga0370483_0000859


Overview

Basic Information
Taxon OID3300034124 Open in IMG/M
Scaffold IDGa0370483_0000859 Open in IMG/M
Source Dataset NamePeat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8513
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (57.14%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States

Source Dataset Sampling Location
Location NameUSA: Alaska
CoordinatesLat. (o)64.9123Long. (o)-147.839Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000065Metagenome / Metatranscriptome2788Y
F006313Metagenome / Metatranscriptome376Y
F023653Metagenome / Metatranscriptome209Y

Sequences

Protein IDFamilyRBSSequence
Ga0370483_0000859_3818_4147F000065N/AMSGIKKLTSKLRKAPEPPLSHAGAAADADRAQRPPLVQPPAPDSELNPGDRVMGLGDFGKPTGGFGTVVRTNEDDALVKWDGDGRMRLRQPWLKKVSSKVHPPPKPASA
Ga0370483_0000859_5815_6057F006313GGAGMAKAQLSAGQVVVIDGMVGVYRVVGVAPDGQKADVEKFDVSSQKSLGDPIRSVAVDKLSSYKEDATEAAARIVREKITED
Ga0370483_0000859_6220_6498F023653AGGAMSVTRLYFECPNCHMQYLLKKGALYYSNGAYIESVAGAPEWQRLLCPCRPGTPHRFKLSETTRLHVFADDENERTHFAPRKHKGSTSPPVKH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.