NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0370515_0012787

Scaffold Ga0370515_0012787


Overview

Basic Information
Taxon OID3300034163 Open in IMG/M
Scaffold IDGa0370515_0012787 Open in IMG/M
Source Dataset NamePeat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3949
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States

Source Dataset Sampling Location
Location NameUSA: Alaska
CoordinatesLat. (o)64.9123Long. (o)-147.839Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004899Metagenome / Metatranscriptome419Y
F014291Metagenome / Metatranscriptome264Y

Sequences

Protein IDFamilyRBSSequence
Ga0370515_0012787_130_432F004899GGAGMLRVEFQDVGETVTMRLEGRFVGPFAEDTRDLLTRCKVPLRFVVNLSEVTFVDAVGEEMLSWLARIGGEFIADNCYPLHVCERLHLPMAPKRARAFSRVM
Ga0370515_0012787_688_1248F014291GAGGMEWFHSSELNKQERPQGSLASSHEIRSAFVEQGDYLNWIALIITGDHALADRAVINASDLSASYSSVFRDWLMGWTNTATVRAAVREVRDLISASASRYIDSSCEHSDNDVLSDDQIASLRHLDTRDIVAALDPLARSALVLRGIQHFSITDCALLLDMPRRIVVAAYCRAVRWNDERAGAQGAPN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.